Recombinant Human Peroxisome proliferator-activated receptor delta (Ppard), partial

In Stock
Code CSB-EP018423HU1
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
FAAR; MGC3931; NR1C2; NUC1; NUCI; NUCII; Nuclear hormone receptor 1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferative activated receptor delta; Peroxisome proliferator-activated receptor beta (PPAR-beta); Peroxisome proliferator-activated receptor beta; Peroxisome proliferator-activated receptor delta; PPAR beta; PPAR-beta; PPAR-delta; PPARB; ppard; PPARD_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
171-441aa
Target Protein Sequence
QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
35.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.
Gene References into Functions
  1. Results suggest that peroxisome proliferator-activated receptor beta overexpression is not an inherent property of breast cancer cell lines, but it may play a role through activation of downstream genes (PPARbeta). PMID: 12009300
  2. 4 polymorphisms were found: -409C/T (promoter, +73C/T (exon 1), +255A/G (exon 3), & +294T/C (exon 4). An interaction with the PPAR alpha L162V polymorphism was also detected for several lipid parameters. PPARD plays a role in cholesterol metabolism. PMID: 12615676
  3. The 15-lipoxygenase-1 product 13-S-hydroxyoctadecadienoic acid down-regulates PPAR-delta to induce apoptosis in colorectal cancer cells. PMID: 12909723
  4. results implicate PPAR-delta in the regulation of intestinal adenoma growth PMID: 14758356
  5. Positive associations of PPAR-delta polymorphisms with fasting plasma glucose and BMI detected in nondiabetic control subjects PMID: 14988273
  6. gene regulation by PPARdelta in the uterine cells uniquely responds to SRC-2, N-CoR, SMRT, or RIP140, and these interactions may be operative during implantation when these cofactors are abundantly expressed. PMID: 15001550
  7. PPAR-beta/delta activation stimulates keratinocyte differentiation, is anti-inflammatory, improves barrier homeostasis, and stimulates triglyceride accumulation in keratinocytes. PMID: 15102088
  8. 11beta-HSD2 is an additional target for PPAR delta, which may regulate human placental function PMID: 15591138
  9. This study was performed to determine whether specific activation of PPARdelta has direct effects on insulin action in skeletal muscle. PMID: 15793256
  10. COX-2 immunopositivity was significantly associated with PPARbeta and PPARgamma immunoreactivity. Microvessel density was significantly higher among PPARbeta-immunoreactive squamous cell carcinomas. PMID: 15811118
  11. PPARdelta signaling pathways are interconnected at the level of cross-regulation of their respective transcription factor mRNA levels PMID: 15890193
  12. PPARdelta expression is up-regulated between the first and third trimester, indicating a role for this nuclear receptor in placental function PMID: 15979543
  13. PPARdelta + 294T/C gene polymorphism in subjects with metabolic syndrome may be involved in the occurrence of obesity and dyslipidemia. PMID: 16053787
  14. PPARdelta partially rescued prostate epithelial cells from growth inhibition and also dramatically inhibited sulindac sulfide-mediated p21WAF1/CIP1 upregulation. PMID: 16091736
  15. PPARdelta +294T/C polymorphism has no influence on plasma lipoprotein concentrations, body mass index or atherosclerotic disease either in healthy subjects or in patients with DM-2, both in males and females. PMID: 16285997
  16. Single nucleotide polymorphisms of PPARD primarily affected insulin sensitivity by modifying glucose uptake in skeletal muscle but not in adipose tissue. PMID: 16306381
  17. The expression of PPARdelta gene in rectal cancers is not statistically different from normal mucosa. PMID: 16361076
  18. Human platelets contain PPARbeta and that its selective activation inhibits platelet aggregation. PMID: 16368717
  19. Data describe the activated form of the peroxisome proliferator-activated receptor-beta/delta using a ligand binding domain model. PMID: 16387648
  20. This review concludes that PPAR delta has emerged as a powerful metabolic regulator in diverse tissues including fat, skeletal muscle, and the heart. PMID: 16511591
  21. PGI2 protects endothelial cells from H2O2-induced apoptosis by inducing PPARdelta binding to 14-3-3alpha promoter, thereby upregulating 14-3-3alpha protein expression. PMID: 16645156
  22. data provide further evidence for an involvement of PPARdelta in the regulation of BMI. PMID: 16652134
  23. Skeletal muscle mRNA expression of PPAR delta increased in type 2 diabetic patients with an improved clinical profile following low-intensity exercise, but were unchanged in patients who did not show exercise-mediated improvements in clinical parameters. PMID: 16752430
  24. Single nucleotide polymorphisms in PPARD modify the conversion from glucose intolerance to type 2 diabetes. PMID: 16804087
  25. Therefore, these results indicate that induction of fatty acid oxidation with PPARbeta activators during short-term exposition is not sufficient to correct for insulin resistance in muscle cells from type 2 diabetic patients. PMID: 16897074
  26. PPARbeta/delta is a novel regulator of endothelial cell proliferation and angiogenesis through VEGF. PMID: 17068288
  27. PPARD-87T/C polymorphism is associated with higher fasting plasma glucose concentrations in both normal glucose tolerant and diabetic subjects, largely due to impaired insulin sensitivity PMID: 17116180
  28. PPAR-delta activation increases cholesterol export and represses inflammatory gene expression in macrophages and atherosclerotic lesions. PMID: 17119917
  29. support the rationale for developing PPARdelta antagonists for prevention and/or treatment of cancer PMID: 17148604
  30. These studies demonstrate that ligand activation of PPARbeta/delta does not lead to an anti-apoptotic effect in either human or mouse keratinocytes, but rather, leads to inhibition of cell growth likely through the induction of terminal differentiation. PMID: 17254750
  31. DNA sequence variation in the PPARdelta locus is a potential modifier of changes in cardiorespiratory fitness and plasma HDL-C in healthy individuals in response to regular exercise. PMID: 17259439
  32. Low PPARD expression is associated with Prostate Cancer Growth. PMID: 29187400
  33. Study demonstrates that oleanolic acid, as a natural product, can ameliorate the high glucose-triggered endothelial function by activating the nuclear receptor PPARdelta. PMID: 28067284
  34. PPARD rs7770619 is a novel candidate variant for impaired fasting glucose and type 2 diabetes and shows association with malondialdehyde levels. PMID: 29776318
  35. The negative responders for aerobic training are carriers of the PPARD rs2267668 G allele. The best responders to aerobic training are PPARD rs1053049 TT and rs2267668 AA. PMID: 29762540
  36. The current results suggest that A/A carriers of PPAR-delta SNP (rs2267668) may enjoy fewer beneficial effects of exercise-centered lifestyle intervention on anthropometric indices and blood measurements. PMID: 29494521
  37. Polymorphism of PPARD is associated with late onset of type 2 diabetes mellitus. PMID: 28292576
  38. findings suggest that PPARdelta conditions CLL cells to survive in harsh microenvironmental conditions by reducing oxidative stress and increasing metabolic efficiency. PMID: 28050012
  39. Here, theauthors describe a novel PPARbeta/delta-dependent molecular cascade involving TGFbeta1 and miR-21-3p, which is activated in the epidermis in response to UV exposure. PMID: 27250636
  40. findings identified previously unrecognized role of IP-PPARdelta signal transduction pathway in the production of sAPPalpha in cerebral microvasculature. PMID: 26661245
  41. the metabolic events, controlled by PPARs, occurring during neuronal precursor differentiation, the glucose and lipid metabolism was investigated. PMID: 27860527
  42. PPAR-delta activation prevents in-stent restenosis and stent thrombosis. PMID: 27283742
  43. findings identify LPCAT3 as a direct PPARdelta target gene and suggest a novel function of PPARdelta in regulation of phospholipid metabolism through LPCAT3. PMID: 27913621
  44. The minor allele of rs2016520 and rs9794 in PPAR-delta and interaction between rs2016520 and non-smoking were associated with decreased risk of CVD. PMID: 28287878
  45. a novel SNP x SNP interaction between rs2267668 in PPARdelta and rs7191411 in EMP2 that has significant impact on circulating HDL-C levels in the Singaporean Chinese population. PMID: 27530449
  46. Results indicate that PPARdelta-mediated downregulation of Nox4 modulates cellular redox status, which in turn plays a critical role in extracellular matrix homeostasis through ROS-dependent regulation of MMP-2 activity. PMID: 26403493
  47. The PPAR-beta role in neuroblastoma cell tumorigenesis and differentiation PMID: 27996177
  48. These observations candidate PPARs as new biomarkers of follicle competence opening new hypotheses on controlled ovarian stimulation effects on ovarian physiology. PMID: 26332656
  49. The PPAR delta role in neuroblastoma cell tumorigenesis and differentiation PMID: 27996177
  50. PPARdelta activation may be a potential risk of atherosclerosis through enhancing activity of SMS2 PMID: 27278004

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity
Ubiquitous with maximal levels in placenta and skeletal muscle.
Database Links

HGNC: 9235

OMIM: 600409

KEGG: hsa:5467

STRING: 9606.ENSP00000310928

UniGene: Hs.696032

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*